Target
Carbonic anhydrase 4
Ligand
BDBM26981
Substrate
n/a
Meas. Tech.
ChEMBL_302638
Ki
80000±n/a nM
Citation
 Innocenti, AFirnges, MAAntel, JWurl, MScozzafava, ASupuran, CT Carbonic anhydrase inhibitors: inhibition of the membrane-bound human isozyme IV with anions. Bioorg Med Chem Lett 14:5769-73 (2004) [PubMed]  Article
Target
Name:
Carbonic anhydrase 4
Synonyms:
CA-IV | Carbonate dehydratase IV | Carbonic anhydrase | Carbonic anhydrase 4 (CA IV) | Carbonic anhydrase IV (CA IV)
Type:
Enzyme
Mol. Mass.:
35037.98
Organism:
Homo sapiens (Human)
Description:
P22748
Residue:
312
Sequence:
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLGPMLACLLAGFLR
  
Inhibitor
Name:
BDBM26981
Synonyms:
CHEMBL1644695 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
Type:
Ion
Emp. Form.:
I
Mol. Mass.:
126.90502
SMILES:
[I-]
Structure:
Search PDB for entries with ligand similarity: