Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 1
LigandBDBM50159467
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306608
IC50>1000±n/a nM
Citation Rivier, JEKirby, DAErchegyi, JWaser, BEltschinger, VCescato, RReubi, JC Somatostatin receptor 1 selective analogues: 3. Dicyclic peptides. J Med Chem48:515-22 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Somatostatin receptor type 1
Name:Somatostatin receptor type 1
Synonyms:SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSTR1 | Somatostatin receptor type 1 (SSTR1)
Type:Enzyme
Mol. Mass.:42692.81
Organism:Homo sapiens (Human)
Description:P30872
Residue:391
Sequence:
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159467
NameBDBM50159467
Synonyms:CHEMBL265839 | cyclo(7-11) Des-AA1,5-[Tyr2,Glu7,D-Trp8,IAmp9,Lys11]SRIF
TypeSmall organic molecule
Emp. Form.C76H104N16O18S2
Mol. Mass.1593.865
SMILESCC(C)NCc1ccc(C[C@@H]2NC(=O)[C@H](Cc3c[nH]c4ccccc34)NC(=O)[C@H]3CCC(=O)NCCCC[C@@H](NC(=O)[C@H](NC2=O)[C@@H](C)O)C(=O)N[C@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](NC(=O)[C@@H](N)Cc2ccc(O)cc2)C(=O)N[C@H](CCCCN)C(=O)N[C@H](Cc2ccccc2)C(=O)N3)C(O)=O)cc1
Structure
n/a