Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRmtA
LigandBDBM50206431
Substrate/Competitorn/a
Meas. Tech.ChEMBL_428528
IC50 1360000±n/a nM
Citation Ragno, RSimeoni, SCastellano, SVicidomini, CMai, ACaroli, ATramontano, ABonaccini, CTrojer, PBauer, IBrosch, GSbardella, G Small molecule inhibitors of histone arginine methyltransferases: homology modeling, molecular docking, binding mode analysis, and biological evaluations. J Med Chem50:1241-53 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RmtA
Name:RmtA
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39351.26
Organism:Emericella nidulans
Description:ChEMBL_475539
Residue:345
Sequence:
MSEIENSTITSSADRMVGMDHAEVRYFTSYDHHGIHEEMLKDDVRTRSYRDSIYQNRHIF
KDKVVLDVGCGTGILSMFAAKAGAKHVIGVDMSSIIEKAREIVAVNGLADKITLLQGKME
EVQLPFPSVDIIISEWMGYFLLYESMLDTVLYAQDRYLVPGGKIFPDKATMYLAGIEDGE
YKDDKIGFWDNVYGFDYSPMKEIALTEPLVDTVELKALVTDPCPIITFDLYTVTKEDLAF
EVPYSLPVKRSDFVHAVIAWFDIEFGACHKPINFSTGPHAKYTHWKQTVFYLRDVLTVEE
EESISGVLSNRPNDKNKRDLDINLTYKLETQDQTRFAEGGCFYRM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50206431
NameBDBM50206431
Synonyms:4-hydroxy-7-(3-phenylthioureido)naphthalene-2-sulfonic acid | CHEMBL384442
TypeSmall organic molecule
Emp. Form.C17H14N2O4S2
Mol. Mass.374.434
SMILESOc1cc(cc2cc(NC(=S)Nc3ccccc3)ccc12)S(O)(=O)=O
Structure
n/a