Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 1B1
LigandBDBM50214610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_459098
IC50 11±n/a nM
Citation Bruno, RDNjar, VC Targeting cytochrome P450 enzymes: a new approach in anti-cancer drug development. Bioorg Med Chem15:5047-60 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 1B1
Name:Cytochrome P450 1B1
Synonyms:CYPIB1 | Cytochrome P450 1B1 (CYP1B1)
Type:PROTEIN
Mol. Mass.:60861.81
Organism:Homo sapiens (Human)
Description:ChEMBL_1474523
Residue:543
Sequence:
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50214610
NameBDBM50214610
Synonyms:3,3',4,4',5-Pentachlorobiphenyl | 3,3',4,4',5-pentachloro-1,1'-biphenyl | 3,4,3',4',5'-Pentachlorobiphenyl | 3,4,5,3',4'-Penta coplanar polychlorinated biphenyl | 3,4,5,3',4'-Pentachlorobiphenyl | CHEMBL342696 | PCB 126
TypeSmall organic molecule
Emp. Form.C12H5Cl5
Mol. Mass.326.433
SMILESClc1ccc(cc1Cl)-c1cc(Cl)c(Cl)c(Cl)c1
Structure
n/a