Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50371322
Substrate/Competitorn/a
Meas. Tech.ChEMBL_463209
Ki 0.79±n/a nM
Citation Wood, MRSchirripa, KMKim, JJKuduk, SDChang, RKDi Marco, CNDiPardo, RMWan, BLMurphy, KLRansom, RWChang, RSHolahan, MACook, JJLemaire, WMosser, SDBednar, RATang, CPrueksaritanont, TWallace, AAMei, QYu, JBohn, DLClayton, FCAdarayn, EDSitko, GRLeonard, YMFreidinger, RMPettibone, DJBock, MG Alpha-hydroxy amides as a novel class of bradykinin B1 selective antagonists. Bioorg Med Chem Lett18:716-20 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50371322
NameBDBM50371322
Synonyms:CHEMBL257729
TypeSmall organic molecule
Emp. Form.C20H16Cl2F4N4O3
Mol. Mass.507.266
SMILESC[C@@H](NC(=O)[C@@](C)(O)C(F)(F)F)c1ncc(cc1F)-c1cc(Cl)cc(Cl)c1-c1nc(C)no1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a