Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50375654
Substrate/Competitorn/a
Meas. Tech.ChEMBL_473866
Ki 30±n/a nM
Citation Fedorov, OMarsden, BPogacic, VRellos, PMüller, SBullock, ANSchwaller, JSundström, MKnapp, S A systematic interaction map of validated kinase inhibitors with Ser/Thr kinases. Proc Natl Acad Sci USA104:20523-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40545.97
Organism:Homo sapiens (Human)
Description:ChEMBL_1467841
Residue:362
Sequence:
MAAAEEEPKPKKLKVEAPQALRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAED
KHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKA
AEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKAR
VCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFA
VLDQDQKEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPD
FH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50375654
NameBDBM50375654
Synonyms:CHEMBL99203
TypeSmall organic molecule
Emp. Form.C11H13IN4O4
Mol. Mass.392.1498
SMILESNc1ncnc2n(cc(I)c12)[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a