Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A3 receptor
LigandBDBM50377678
Substrate/Competitorn/a
Meas. Tech.ChEMBL_479904
Ki 6.1±n/a nM
Citation Melman, AGao, ZGKumar, DWan, TCGizewski, EAuchampach, JAJacobson, KA Design of (N)-methanocarba adenosine 5'-uronamides as species-independent A3 receptor-selective agonists. Bioorg Med Chem Lett18:2813-9 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A3 receptor
Name:Adenosine A3 receptor
Synonyms:A3AR | Adenosine receptor A3
Type:PROTEIN
Mol. Mass.:36460.91
Organism:Mus musculus
Description:ChEMBL_1515686
Residue:319
Sequence:
MEADNTTETDWLNITYITMEAAIGLCAVVGNMLVIWVVKLNPTLRTTTVYFIVSLALADI
AVGVLVIPLAIAVSLQVKMHFYACLFMSCVLLIFTHASIMSLLAIAVHRYLRVKLTVRYR
TVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKATLASSQNSSTLLCHFRSVVSLDYMVF
FSFITWILVPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLF
ALCWLPLSIINFVSYFDVKIPDVAMCLGILLSHANSMMNPIVYACKIKKFKETYFLILRA
VRLCQTSDSLDSNMEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50377678
NameBDBM50377678
Synonyms:CHEMBL258421
TypeSmall organic molecule
Emp. Form.C25H27ClN6O3
Mol. Mass.494.973
SMILESCCCC#Cc1nc(NCc2cccc(Cl)c2)c2ncn([C@@H]3[C@H]4C[C@]4([C@@H](O)[C@H]3O)C(=O)NC)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a