Target
4-hydroxy-tetrahydrodipicolinate synthase
Ligand
BDBM19472
Substrate
n/a
Meas. Tech.
ChEMBL_536820
Ki
16000±n/a nM
Citation
 Boughton, BAGriffin, MDO'Donnell, PADobson, RCPerugini, MAGerrard, JAHutton, CA Irreversible inhibition of dihydrodipicolinate synthase by 4-oxo-heptenedioic acid analogues. Bioorg Med Chem 16:9975-83 (2008) [PubMed]  Article
Target
Name:
4-hydroxy-tetrahydrodipicolinate synthase
Synonyms:
Dihydrodipicolinate synthase
Type:
PROTEIN
Mol. Mass.:
31269.12
Organism:
Escherichia coli (strain K12)
Description:
ChEMBL_536816
Residue:
292
Sequence:
MFTGSIVAIVTPMDEKGNVCRASLKKLIDYHVASGTSAIVSVGTTGESATLNHDEHADVVMMTLDLADGRIPVIAGTGANATAEAISLTQRFNDSGIVGCLTVTPYYNRPSQEGLYQHFKAIAEHTDLPQILYNVPSRTGCDLLPETVGRLAKVKNIIGIKEATGNLTRVNQIKELVSDDFVLLSGDDASALDFMQLGGHGVISVTANVAARDMAQMCKLAAEGHFAEARVINQRLMPLHNKLFVEPNPIPVKWACKELGLVATDTLRLPMTPITDSGRETVRAALKHAGLL
  
Inhibitor
Name:
BDBM19472
Synonyms:
2-oxoacetic acid | Glyoxylate | Oxoethanoic acid | glyoxylic acid | oxaldehydic acid
Type:
Small organic molecule
Emp. Form.:
C2H2O3
Mol. Mass.:
74.0355
SMILES:
OC(=O)C=O
Structure:
Search PDB for entries with ligand similarity: