Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase
LigandBDBM50295553
Substrate/Competitorn/a
Meas. Tech.ChEMBL_580262
IC50 200±n/a nM
Citation Wei, SDaniel, BJBrumlik, MJBurow, MEZou, WKhan, IAWadsworth, SSiekierka, JCuriel, TJ Drugs designed to inhibit human p38 mitogen-activated protein kinase activation treat Toxoplasma gondii and Encephalitozoon cuniculi infection. Antimicrob Agents Chemother51:4324-8 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase
Name:Mitogen-activated protein kinase
Synonyms:Mitogen-activated protein kinase 1
Type:PROTEIN
Mol. Mass.:58376.75
Organism:Toxoplasma gondii
Description:ChEMBL_580262
Residue:532
Sequence:
MSQSTSAGGSQAVAQNPGAKLGFSMRSASIASDSVPCESGLCEAPPGVLSGAGTVFCEST
YKVKIDNETVWQVPTRLKFVKKVGSGAYGCVASFEDTSASASEQGTEDDPSRREQSGETR
TSQTGSAEGDSGTNKKVAVKKIGDLFRDLIDAKRIYREIKILKELKHENIINLVEILDPL
TPDFEDIYLVSDLMDTDLHRVIYSRQPLTPEHHQYFLYQLLLGLSFLHQADIIHRDLKPS
NILVNLNCDIKICDFGLARGLNMNPAPPPNLLPPATHRAGPAAAQDVVCTYTPPDNLSGA
GKWGDQKLAAAAGAGSIAATRLVRLAHQQGSSLIGAQHQVPAKTDDASDDMELTDYVVTR
WYRPPEILISPFCYSKPVDLWSVGCIFAELLGRRALFAGKDHFDQLRRIVRVLGRPSTAE
INKVANEGRGRHFNNPSKGTSNTKRKRSEAARRFIESLPNSDPYKLEDLFPDASKAALDL
LSNLLTFDPAKRITVQEALRHEYFEGLHSVEDEPTVTTPVNWSFDNFVPTKR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50295553
NameBDBM50295553
Synonyms:4-(4-(4-fluorophenyl)-1-(3-phenylpropyl)-5-(pyridin-4-yl)-1H-imidazol-2-yl)but-3-yn-1-ol | 4-[4-(4-Fluoro-phenyl)-1-(3-phenyl-propyl)-5-pyridin-4-yl-1H-imidazol-2-yl]-but-3-yn-1-ol | CHEMBL190333 | RWJ-67657 | US11273153, Compound RWJ67657
TypeSmall organic molecule
Emp. Form.C27H24FN3O
Mol. Mass.425.4974
SMILESOCCC#Cc1nc(c(-c2ccncc2)n1CCCc1ccccc1)-c1ccc(F)cc1
Structure
n/a