Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR3A
LigandBDBM50081969
Substrate/Competitorn/a
Meas. Tech.ChEMBL_592422
Kd 954.99±n/a nM
Citation Butini, SBudriesi, RHamon, MMorelli, EGemma, SBrindisi, MBorrelli, GNovellino, EFiorini, IIoan, PChiarini, ACagnotto, AMennini, TFracasso, CCaccia, SCampiani, G Novel, potent, and selective quinoxaline-based 5-HT(3) receptor ligands. 1. Further structure-activity relationships and pharmacological characterization. J Med Chem52:6946-50 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR3A
Name:HTR3A
Synonyms:5-HT3 | 5-hydroxytryptamine receptor 3A | Serotonin 3a (5-HT3a) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:55657.07
Organism:GUINEA PIG
Description:5-HT3 HTR3A GUINEA PIG::O70212
Residue:490
Sequence:
MVLWLQLALLALLLPTSLAQGEVRGKGTAQAHNSTRPALQRLSDHLLADYRKSVRPVRDW
RKPTTVSIDAIVYAILSVDEKNQVLTTYIWYRQFWTDEFLQWNPEDFDNITKLSIPTDSI
WVPDILINEFVDVGKSPNIPYVYVRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRLPEKVKSDKSVFMNQGEWELLGVLTEFLEFSDRESRGSFAEMKF
YVVIRRRPLFYAVTLLLPSIFLMIVDIVGFYLPPDSGERVSFKITLLLGYSVFLIIVSDT
LPATAIGTPLISVYFVVCMALLVISLAETILIVRLVHKQDLQQPVPLWLRHLVLERIAGL
LCLGEQLTSHRGPATLQATKTDDFSGSTLLPAMGNHCGPLGGPQDLEKTSRGRGSPPPPP
REASLAMCGLLQELASIRHFLEKREETREVARDWLRVGSVLDKLLFRVYLLAVLAYSITL
VTLWSVWHYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50081969
NameBDBM50081969
Synonyms:9-Methyl-4-(4-methyl-piperazin-1-yl)-pyrrolo[1,2-a]quinoxaline | 9-methyl-4-(4-methylpiperazin-1-yl)pyrrolo[1,2-a]quinoxaline | CHEMBL136978
TypeSmall organic molecule
Emp. Form.C17H20N4
Mol. Mass.280.3675
SMILESCN1CCN(CC1)c1nc2cccc(C)c2n2cccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a