Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2X purinoceptor 4
LigandBDBM50268965
Substrate/Competitorn/a
Meas. Tech.ChEMBL_718658
IC50>10000±n/a nM
Citation Baqi, YHausmann, RRosefort, CRettinger, JSchmalzing, GMüller, CE Discovery of potent competitive antagonists and positive modulators of the P2X2 receptor. J Med Chem54:817-30 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2X purinoceptor 4
Name:P2X purinoceptor 4
Synonyms:Purinergic, P2X4
Type:Enzyme Catalytic Domain
Mol. Mass.:43504.16
Organism:RAT
Description:Purinergic, P2X4 0 RAT::P51577
Residue:388
Sequence:
MAGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSV
VSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIP
DKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGVPTPAFLK
AAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTDPFCPIFRLGTIVEDAG
HSFQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYY
RDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYC
MKKKYYYRDKKYKYVEDYEQGLSGEMNQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50268965
NameBDBM50268965
Synonyms:CHEMBL499428 | Disodium 1-amino-4-[4-([1,3]diazine-2-ylamino)-3-sulfophenylamino]-9,10-dioxo-9,10-dihydroanthracene-2-sulfonate
TypeSmall organic molecule
Emp. Form.C24H15N5O8S2
Mol. Mass.565.536
SMILESNc1c(cc(Nc2ccc(Nc3ncccn3)c(c2)S([O-])(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a