Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSolute carrier family 22 member 6
LigandBDBM50009999
Substrate/Competitorn/a
Meas. Tech.ChEMBL_749026
Ki 27500±n/a nM
Citation Kouznetsova, VLTsigelny, IFNagle, MANigam, SK Elucidation of common pharmacophores from analysis of targeted metabolites transported by the multispecific drug transporter-Organic anion transporter1 (Oat1). Bioorg Med Chem19:3320-40 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Solute carrier family 22 member 6
Name:Solute carrier family 22 member 6
Synonyms:Organic anion transporter 1 | rOAT1 | rROAT1 | renal organic anion transporter 1
Type:PROTEIN
Mol. Mass.:60784.17
Organism:Rattus norvegicus
Description:ChEMBL_838479
Residue:551
Sequence:
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPPHHCRPPANANLSKD
GGLEAWLPLDKQGQPESCLRFTSPQWGPPFYNGTEANGTRVTEPCIDGWVYDNSTFPSTI
VTEWNLVCSHRAFRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
YAPNYTVYCVFRLLSGMSLASIAINCMTLNVEWMPIHTRAYVGTLIGYVYSLGQFLLAGI
AYAVPHWRHLQLVVSVPFFIAFIYSWFFIESARWYSSSGRLDLTLRALQRVARINGKQEE
GAKLSIEVLRTSLQKELTLSKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQMASLLLAGICILVNGIIPKSHT
IIRTSLAVLGKGCLASSFNCIFLYTGELYPTVIRQTGLGMGSTMARVGSIVSPLVSMTAE
FYPSMPLFIFGAVPVVASAVTALLPETLGQPLPDTVQDLKSRSRGKQNQQQQEQQKQMMP
LQASTQEKNGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009999
NameBDBM50009999
Synonyms:CHEMBL461 | N-benzoylglycine
TypeSmall organic molecule
Emp. Form.C9H9NO3
Mol. Mass.179.1727
SMILESOC(=O)CNC(=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a