Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaM kinase I delta
LigandBDBM50380246
Substrate/Competitorn/a
Meas. Tech.ChEMBL_813554
IC50>40000±n/a nM
Citation Maryanoff, BEMcComsey, DFYabut, SCLuci, DKJordan, ADMasucci, JAJones, WJAbad, MCGibbs, ACPetrounia, I Inhibitors of Ketohexokinase: Discovery of Pyrimidinopyrimidines with Specific Substitution that Complements the ATP-Binding Site. ACS Med Chem Lett2:538-543 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CaM kinase I delta
Name:CaM kinase I delta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:42916.83
Organism:Homo sapiens (Human)
Description:ChEMBL_586559
Residue:385
Sequence:
MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALK
GKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKD
ASTLIRQVLDAVYYLHRMGIVHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMST
ACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDSKLFEQILKAEYEF
DSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIAGDTALNKNIHESVSAQIRKN
FAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAPSTLCSFISSS
SGVSGVGAERRPRPTTVTAVHSGSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50380246
NameBDBM50380246
Synonyms:CHEMBL2017214
TypeSmall organic molecule
Emp. Form.C21H26N8S
Mol. Mass.422.55
SMILESCSc1ccccc1Nc1nc(nc2c(NCC3CC3)ncnc12)N1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a