Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBiotin--protein ligase
LigandBDBM50388928
Substrate/Competitorn/a
Meas. Tech.ChEMBL_831149
Ki>20000±n/a nM
Citation Soares da Costa, TPTieu, WYap, MYZvarec, OBell, JMTurnidge, JDWallace, JCBooker, GWWilce, MCAbell, ADPolyak, SW Biotin analogues with antibacterial activity are potent inhibitors of biotin protein ligase. ACS Med Chem Lett3:509-514 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Biotin--protein ligase
Name:Biotin--protein ligase
Synonyms:Biotin apo-protein ligase | Biotin--[acetyl-CoA-carboxylase] ligase | Biotin--[methylcrotonoyl-CoA-carboxylase] ligase | Biotin--[methylmalonyl-CoA-carboxytransferase] ligase | Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase | HCS | HLCS | Holocarboxylase synthetase
Type:PROTEIN
Mol. Mass.:80745.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1475435
Residue:726
Sequence:
MEDRLHMDNGLVPQKIVSVHLQDSTLKEVKDQVSNKQAQILEPKPEPSLEIKPEQDGMEH
VGRDDPKALGEEPKQRRGSASGSEPAGDSDRGGGPVEHYHLHLSSCHECLELENSTIESV
KFASAENIPDLPYDYSSSLESVADETSPEREGRRVNLTGKAPNILLYVGSDSQEALGRFH
EVRSVLADCVDIDSYILYHLLEDSALRDPWTDNCLLLVIATRESIPEDLYQKFMAYLSQG
GKVLGLSSSFTFGGFQVTSKGALHKTVQNLVFSKADQSEVKLSVLSSGCRYQEGPVRLSP
GRLQGHLENEDKDRMIVHVPFGTRGGEAVLCQVHLELPPSSNIVQTPEDFNLLKSSNFRR
YEVLREILTTLGLSCDMKQVPALTPLYLLSAAEEIRDPLMQWLGKHVDSEGEIKSGQLSL
RFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNLQTKQLGKVILFAEVTPTTMR
LLDGLMFQTPQEMGLIVIAARQTEGKGRGGNVWLSPVGCALSTLLISIPLRSQLGQRIPF
VQHLMSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSTLMGETFYILIGC
GFNVTNSNPTICINDLITEYNKQHKAELKPLRADYLIARVVTVLEKLIKEFQDKGPNSVL
PLYYRYWVHSGQQVHLGSAEGPKVSIVGLDDSGFLQVHQEGGEVVTVHPDGNSFDMLRNL
ILPKRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50388928
NameBDBM50388928
Synonyms:CHEMBL2063399
TypeSmall organic molecule
Emp. Form.C11H20N2O2S
Mol. Mass.244.354
SMILESOCCCCCC[C@@H]1SC[C@@H]2NC(=O)N[C@H]12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a