Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPolyunsaturated fatty acid lipoxygenase ALOX15
LigandBDBM50143435
Substrate/Competitorn/a
Meas. Tech.ChEMBL_840271
IC50 16700±n/a nM
Citation Iranshahi, MJabbari, AOrafaie, AMehri, RZeraatkar, SAhmadi, TAlimardani, MSadeghian, H Synthesis and SAR studies of mono O-prenylated coumarins as potent 15-lipoxygenase inhibitors. Eur J Med Chem57:134-42 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Polyunsaturated fatty acid lipoxygenase ALOX15
Name:Polyunsaturated fatty acid lipoxygenase ALOX15
Synonyms:15-Lipoxygenase-1 (15-LOX-1) | Arachidonate 15-lipoxygenase | Arachidonate 15-lipoxygenase-1 | Reticulocyte 15-lipoxygenase-1 | Sphingosine 1-phosphate receptor 1 (S1P1)
Type:Protein
Mol. Mass.:74804.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:662
Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50143435
NameBDBM50143435
Synonyms:7-((2E,6E)-3,7,11-Trimethyl-dodeca-2,6,10-trienyloxy)-chromen-2-one | CHEMBL156127
TypeSmall organic molecule
Emp. Form.C24H30O3
Mol. Mass.366.4932
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#8]-c1ccc2ccc(=O)oc2c1
Structure
n/a