Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
LigandBDBM50391191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_840812
IC50>10000±n/a nM
Citation Bruel, ALogé, CTauzia, MLRavache, MLe Guevel, RGuillouzo, CLohier, JFOliveira Santos, JSLozach, OMeijer, LRuchaud, SBénédetti, HRobert, JM Synthesis and biological evaluation of new 5-benzylated 4-oxo-3,4-dihydro-5H-pyridazino[4,5-b]indoles as PI3Ka inhibitors. Eur J Med Chem57:225-33 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Name:Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Synonyms:Dual specificity tyrosine-phosphorylation-regulated kinase 1A
Type:Enzyme Catalytic Domain
Mol. Mass.:85573.59
Organism:RAT
Description:Dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A 0 RAT::Q63470
Residue:763
Sequence:
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391191
NameBDBM50391191
Synonyms:CHEMBL2088669
TypeSmall organic molecule
Emp. Form.C19H13FN4O
Mol. Mass.332.3311
SMILESCc1n[nH]c(=O)c2n(Cc3cccc(c3)C#N)c3ccc(F)cc3c12
Structure
n/a