Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E synthase
LigandBDBM50391884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_849365
IC50 11000±n/a nM
Citation Baumgartner, LSosa, SAtanasov, AGBodensieck, AFakhrudin, NBauer, JFavero, GDPonti, CHeiss, EHSchwaiger, SLadurner, AWidowitz, ULoggia, RDRollinger, JMWerz, OBauer, RDirsch, VMTubaro, AStuppner, H Lignan derivatives from Krameria lappacea roots inhibit acute inflammation in vivo and pro-inflammatory mediators in vitro. J Nat Prod74:1779-86 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E synthase
Name:Prostaglandin E synthase
Synonyms:Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1)
Type:Protein
Mol. Mass.:17112.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:152
Sequence:
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50391884
NameBDBM50391884
Synonyms:CHEMBL463574
TypeSmall organic molecule
Emp. Form.C18H16O2
Mol. Mass.264.3184
SMILESC\C=C\c1ccc2oc(c(C)c2c1)-c1ccc(O)cc1
Structure
n/a