Reaction Details |
 | Report a problem with these data |
Target | Prostaglandin E synthase |
---|
Ligand | BDBM50391884 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_849365 |
---|
IC50 | 11000±n/a nM |
---|
Citation | Baumgartner, L; Sosa, S; Atanasov, AG; Bodensieck, A; Fakhrudin, N; Bauer, J; Favero, GD; Ponti, C; Heiss, EH; Schwaiger, S; Ladurner, A; Widowitz, U; Loggia, RD; Rollinger, JM; Werz, O; Bauer, R; Dirsch, VM; Tubaro, A; Stuppner, H Lignan derivatives from Krameria lappacea roots inhibit acute inflammation in vivo and pro-inflammatory mediators in vitro. J Nat Prod74:1779-86 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin E synthase |
---|
Name: | Prostaglandin E synthase |
Synonyms: | Prostaglandin E synthase (PGES-1) | Prostaglandin E synthase 1 (mPGES-1) | Prostaglandin E synthase-1 (PGES-1) | Prostaglandin E synthase/G/H synthase 2 | Prostaglandin E2 synthase-1 ( mPGES-1) |
Type: | Protein |
Mol. Mass.: | 17112.22 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 152 |
Sequence: | MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
|
|
|
BDBM50391884 |
---|
Name | BDBM50391884 |
Synonyms: | CHEMBL463574 |
Type | Small organic molecule |
Emp. Form. | C18H16O2 |
Mol. Mass. | 264.3184 |
SMILES | C\C=C\c1ccc2oc(c(C)c2c1)-c1ccc(O)cc1 |
Structure |  |
n/a |
---|