Target
Prostaglandin G/H synthase 1
Ligand
BDBM50391884
Substrate
n/a
Meas. Tech.
ChEMBL_849361
IC50
3000±n/a nM
Citation
 Baumgartner, LSosa, SAtanasov, AGBodensieck, AFakhrudin, NBauer, JFavero, GDPonti, CHeiss, EHSchwaiger, SLadurner, AWidowitz, ULoggia, RDRollinger, JMWerz, OBauer, RDirsch, VMTubaro, AStuppner, H Lignan derivatives from Krameria lappacea roots inhibit acute inflammation in vivo and pro-inflammatory mediators in vitro. J Nat Prod 74:1779-86 (2011) [PubMed]  Article
Target
Name:
Prostaglandin G/H synthase 1
Synonyms:
Cyclooxygenase-1 | Cyclooxygenase-1 (COX-1) | Prostaglandin G/H synthase (cyclooxygenase)
Type:
Protein
Mol. Mass.:
68868.60
Organism:
Ovis aries (Sheep)
Description:
n/a
Residue:
600
Sequence:
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRRFLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
  
Inhibitor
Name:
BDBM50391884
Synonyms:
CHEMBL463574
Type:
Small organic molecule
Emp. Form.:
C18H16O2
Mol. Mass.:
264.3184
SMILES:
C\C=C\c1ccc2oc(c(C)c2c1)-c1ccc(O)cc1
Structure:
Search PDB for entries with ligand similarity: