Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Lysine Demethylase
LigandBDBM50396020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861177
IC50 180±n/a nM
Citation Decarlo, DHadden, MK Oncoepigenomics: making histone lysine methylation count. Eur J Med Chem56:179-194 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone Lysine Demethylase
Name:Histone Lysine Demethylase
Synonyms:2-OG-Dependent Histone Demethylase JMJD2E | Jumonji domain-containing protein 2E (JMJD2E) | KDM4D-like protein | Lysine-specific demethylase 4D-like | Lysine-specific demethylase 4E | Lysine-specific demethylase 4E (KDM4E)
Type:Enzyme
Mol. Mass.:56815.71
Organism:Homo sapiens (Human)
Description:B2RXH2
Residue:506
Sequence:
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396020
NameBDBM50396020
Synonyms:CHEMBL1615036
TypeSmall organic molecule
Emp. Form.C14H14N4O3
Mol. Mass.286.286
SMILESNCCNC(=O)c1ccnc(c1)-c1cc(ccn1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a