Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSET and MYND domain-containing protein 2 (SMYD2)
LigandBDBM50396022
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861196
Ki 300±n/a nM
Citation Decarlo, DHadden, MK Oncoepigenomics: making histone lysine methylation count. Eur J Med Chem56:179-194 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
SET and MYND domain-containing protein 2 (SMYD2)
Name:N-lysine methyltransferase SMYD2
Synonyms:HSKM-B | Histone methyltransferase SMYD2 | KMT3C | Lysine N-methyltransferase 3C | N-lysine methyltransferase SMYD2 | SET and MYND domain-containing protein 2 | SMYD2
Type:Enzyme
Mol. Mass.:49689.57
Organism:Homo sapiens (Human)
Description:Q9NRG4
Residue:433
Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396022
NameBDBM50396022
Synonyms:CHEMBL2169920
TypeSmall organic molecule
Emp. Form.C29H38Cl2N4O4
Mol. Mass.577.542
SMILESOc1ccc(CCNCCN(C2CCCCC2)C(=O)CCNCCc2ccc(Cl)c(Cl)c2)c2OCC(=O)Nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a