Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone-lysine N-methyltransferase SUV39H1
LigandBDBM50134315
Substrate/Competitorn/a
Meas. Tech.ChEMBL_861232
IC50 260±n/a nM
Citation Decarlo, DHadden, MK Oncoepigenomics: making histone lysine methylation count. Eur J Med Chem56:179-194 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone-lysine N-methyltransferase SUV39H1
Name:Histone-lysine N-methyltransferase SUV39H1
Synonyms:H3-K9-HMTase 1 | Histone H3-K9 methyltransferase 1 | KMT1A | Lysine N-methyltransferase 1A | Position-effect variegation 3-9 homolog | SUV39H | SUV39H1 | Su(var)3-9 homolog 1 | Suppressor of variegation 3-9 homolog 1
Type:PROTEIN
Mol. Mass.:47917.07
Organism:Homo sapiens (Human)
Description:ChEMBL_1473655
Residue:412
Sequence:
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134315
NameBDBM50134315
Synonyms:7-hydroxy-11-hydroxymethyl-12-methyl-14,15-dithia-9,12-diazatetracyclo[9.2.2.01,9.03,8]pentadeca-3,5-diene-10,13-dione | CHEMBL331627 | GLIOTOXIN
TypeSmall organic molecule
Emp. Form.C13H14N2O4S2
Mol. Mass.326.391
SMILESCN1C(=O)[C@]23CC4=CC=C[C@H](O)[C@H]4N2C(=O)[C@@]1(CO)SS3 |r,c:8,t:6,THB:12:13:1.2:19.20,15:14:1.2:19.20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a