Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50398057
Substrate/Competitorn/a
Meas. Tech.ChEMBL_873466
Ki 0.002500±n/a nM
Citation James, MLShen, BZavaleta, CLNielsen, CHMesangeau, CVuppala, PKChan, CAvery, BAFishback, JAMatsumoto, RRGambhir, SSMcCurdy, CRChin, FT New positron emission tomography (PET) radioligand for imagings-1 receptors in living subjects. J Med Chem55:8272-82 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Opioid receptor | Sigma | Sigma opioid receptor | Sigma-1
Type:Enzyme Catalytic Domain
Mol. Mass.:25266.54
Organism:RAT
Description:Q9R0C9
Residue:223
Sequence:
MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50398057
NameBDBM50398057
Synonyms:CHEMBL2181924
TypeSmall organic molecule
Emp. Form.C18H25FN2OS
Mol. Mass.336.467
SMILESFCCCc1ccc2n(CCN3CCCCCC3)c(=O)sc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a