Target
Neutrophil elastase
Ligand
BDBM50406196
Substrate
n/a
Meas. Tech.
ChEMBL_21101
Ki
3.981E2±n/a nM
KOFF
3.89E-5 s-1
KON
9.772E1 M-1s-1
Citation
 Krantz, ASpencer, RWTam, TFLiak, TJCopp, LJThomas, EMRafferty, SP Design and synthesis of 4H-3,1-benzoxazin-4-ones as potent alternate substrate inhibitors of human leukocyte elastase. J Med Chem 33:464-79 (1990) [PubMed]  Article
Target
Name:
Neutrophil elastase
Synonyms:
Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:
Enzyme
Mol. Mass.:
28532.38
Organism:
Homo sapiens (Human)
Description:
P08246
Residue:
267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
  
Inhibitor
Name:
BDBM50406196
Synonyms:
CHEMBL335798
Type:
Small organic molecule
Emp. Form.:
C15H20N2O2
Mol. Mass.:
260.3315
SMILES:
CC(C)N(C(C)C)c1nc2cccc(C)c2c(=O)o1
Structure:
Search PDB for entries with ligand similarity: