Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSynaptic vesicle glycoprotein 2A
LigandBDBM50422542
Substrate/Competitorn/a
Meas. Tech.ChEMBL_100153
IC50 794±n/a nM
Citation Kenda, BMMatagne, ACTalaga, PEPasau, PMDifferding, ELallemand, BIFrycia, AMMoureau, FGKlitgaard, HVGillard, MRFuks, BMichel, P Discovery of 4-substituted pyrrolidone butanamides as new agents with significant antiepileptic activity. J Med Chem47:530-49 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Synaptic vesicle glycoprotein 2A
Name:Synaptic vesicle glycoprotein 2A
Synonyms:Synaptic vesicle protein 2a
Type:PROTEIN
Mol. Mass.:82648.76
Organism:Rattus norvegicus
Description:ChEMBL_100153
Residue:742
Sequence:
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPA
PADGYYRGEGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKDREELAQQYETILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50422542
NameBDBM50422542
Synonyms:Keppra | Keppra Xr | LEVETIRACETAM | Levetiracetam In Sodium Chloride | UCB-22059 | UCB-L059
TypeSmall organic molecule
Emp. Form.C8H14N2O2
Mol. Mass.170.209
SMILESCC[C@H](N1CCCC1=O)C(N)=O |r|
Structure
n/a