Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM50413555
Substrate/Competitorn/a
Meas. Tech.ChEMBL_501239
Ki 0.1±n/a nM
Citation Bromidge, SMBertani, BBorriello, MBozzoli, AFaedo, SGianotti, MGordon, LJHill, MZucchelli, VWatson, JMZonzini, L 8-[2-(4-Aryl-1-piperazinyl)ethyl]-2H-1,4-benzoxazin-3(4H)-ones: dual-acting 5-HT1 receptor antagonists and serotonin reuptake inhibitors--part II. Bioorg Med Chem Lett19:2338-42 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50413555
NameBDBM50413555
Synonyms:CHEMBL469568
TypeSmall organic molecule
Emp. Form.C27H30N4O2
Mol. Mass.442.5527
SMILESCc1ccc2c(cccc2n1)N1CCN(CCc2cccc3N(C4CC4)C(=O)COc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a