Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM50415165
Substrate/Competitorn/a
Meas. Tech.ChEMBL_595183
Ki 0.0575±n/a nM
Citation Piergentili, AAmantini, CDel Bello, FGiannella, MMattioli, LPalmery, MPerfumi, MPigini, MSantoni, GTucci, PZotti, MQuaglia, W Novel highly potent and selective sigma 1 receptor antagonists related to spipethiane. J Med Chem53:1261-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Aging-associated gene 8 protein | SIG-1R | SR-BP | SR31747-binding protein | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1
Type:Enzyme Catalytic Domain
Mol. Mass.:25124.85
Organism:Homo sapiens (Human)
Description:Sigma 0 HUMAN::Q99720
Residue:223
Sequence:
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50415165
NameBDBM50415165
Synonyms:CHEMBL570795
TypeSmall organic molecule
Emp. Form.C21H25NS
Mol. Mass.323.495
SMILESC(N1CCC(CC1)C1CCc2ccccc2S1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a