Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-1 adrenergic receptor
LigandBDBM82482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_37105
Ki 76±n/a nM
Citation Markovich, KMTantishaiyakul, VHamada, AMiller, DDRomstedt, KJShams, GShin, YFraundorfer, PFDoyle, KFeller, DR Synthesis of halogenated trimetoquinol derivatives and evaluation of their beta-agonist and thromboxane A2 (TXA2) antagonist activities. J Med Chem35:466-79 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-1 adrenergic receptor
Name:Beta-1 adrenergic receptor
Synonyms:ADRB1 | Adrenergic receptor | adrenergic Beta1
Type:Enzyme Catalytic Domain
Mol. Mass.:50540.48
Organism:GUINEA PIG
Description:adrenergic Beta1 ADRB1 GUINEA PIG::B0FL73
Residue:467
Sequence:
MGAGVLALGASEPCNLSSTAPLPDGAATAARLLVPASPPASLLPPTSEGSEPLSPQWTAG
MGLLMVLIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARVLVC
TVWAISALVSFLPILMHWWRAEGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPGRPPSPVPSPTPGSPRAATDPLANGRTSKRR
PSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANS
AFNPIIYCRSPDFRKAFQRLLCCARRAARRRHTAHGGRPRASGCLARSGPPPSPGAASDE
DEDAVGAAPPARLLEPWAGCNGGAATADSDWSLDEPGRAGFASESKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82482
NameBDBM82482
Synonyms:TMQ, S-(+)-8-Fluoro
TypeSmall organic molecule
Emp. Form.C19H22FNO5
Mol. Mass.363.3801
SMILESCOc1cc(C[C@@H]2NCCc3cc(O)c(O)c(F)c23)cc(OC)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a