Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEBifunctional epoxide hydrolase 2
LigandBDBM50327809
Substrate/Competitorn/a
Meas. Tech.ChEMBL_967730
IC50 3.7±n/a nM
Citation Hwang, SHWecksler, ATZhang, GMorisseau, CNguyen, LVFu, SHHammock, BD Synthesis and biological evaluation of sorafenib- and regorafenib-like sEH inhibitors. Bioorg Med Chem Lett23:3732-7 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EBifunctional epoxide hydrolase 2
Name:EBifunctional epoxide hydrolase 2
Synonyms:Cytosolic epoxide hydrolase 2 | Lipid-phosphate phosphatase | Soluble epoxide hydrolase (sEH) | epoxide hydrolase 2, cytoplasmic
Type:Enzyme
Mol. Mass.:62613.07
Organism:Homo sapiens (Human)
Description:P34913
Residue:555
Sequence:
MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITL
SQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARKINRPMLQAALMLRKKGFTTA
ILTNTWLDDRAERDGLAQLMCELKMHFDFLIESCQVGMVKPEPQIYKFLLDTLKASPSEV
VFLDDIGANLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHG
YVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS
APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNT
PFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMH
KVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSL
GRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIK
WLDSDARNPPVVSKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50327809
NameBDBM50327809
Synonyms:1-(1-Propionylpiperidin-4-yl)-3-(4-(trifluoromethoxy)phenyl)urea | CHEMBL1258904 | US10383835, Compound 1770 | US9296693, 40
TypeSmall organic molecule
Emp. Form.C16H20F3N3O3
Mol. Mass.359.3435
SMILESCCC(=O)N1CCC(CC1)NC(=O)Nc1ccc(OC(F)(F)F)cc1
Structure
n/a