Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A3 receptor
LigandBDBM50437190
Substrate/Competitorn/a
Meas. Tech.ChEMBL_969851
Ki 11±n/a nM
Citation Paoletta, STosh, DKFinley, AGizewski, ETMoss, SMGao, ZGAuchampach, JASalvemini, DJacobson, KA Rational design of sulfonated A3 adenosine receptor-selective nucleosides as pharmacological tools to study chronic neuropathic pain. J Med Chem56:5949-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A3 receptor
Name:Adenosine A3 receptor
Synonyms:A3AR | Adenosine receptor A3
Type:PROTEIN
Mol. Mass.:36460.91
Organism:Mus musculus
Description:ChEMBL_1515686
Residue:319
Sequence:
MEADNTTETDWLNITYITMEAAIGLCAVVGNMLVIWVVKLNPTLRTTTVYFIVSLALADI
AVGVLVIPLAIAVSLQVKMHFYACLFMSCVLLIFTHASIMSLLAIAVHRYLRVKLTVRYR
TVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKATLASSQNSSTLLCHFRSVVSLDYMVF
FSFITWILVPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFLF
ALCWLPLSIINFVSYFDVKIPDVAMCLGILLSHANSMMNPIVYACKIKKFKETYFLILRA
VRLCQTSDSLDSNMEQTTE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50437190
NameBDBM50437190
Synonyms:CHEMBL2401955
TypeSmall organic molecule
Emp. Form.C28H25ClN6O6S
Mol. Mass.609.053
SMILESCNC(=O)[C@@]12C[C@@H]1[C@H]([C@H](O)[C@@H]2O)n1cnc2c(NCc3cccc(Cl)c3)nc(nc12)C#Cc1cccc(c1)S(O)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a