Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-carbonic anhydrase
LigandBDBM10880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1280424
Ki 27±n/a nM
Citation Vullo, DSai Kumar, RSScozzafava, ACapasso, CFerry, JGSupuran, CT Anion inhibition studies of aß-carbonic anhydrase from Clostridium perfringens. Bioorg Med Chem Lett23:6706-10 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-carbonic anhydrase
Name:Beta-carbonic anhydrase
Synonyms:Carbonate dehydratase | Carbonic anhydrase | FbiCA1
Type:Protein
Mol. Mass.:35543.44
Organism:Vibrio cholerae
Description:P46510
Residue:330
Sequence:
MSAASAFAMNAPSFVNASSLKKASTSARSGVLSARFTCNSSSSSSSSATPPSLIRNEPVF
AAPAPIITPNWTEDGNESYEEAIDALKKTLIEKGELEPVAATRIDQITAQAAAPDTKAPF
DPVERIKSGFVKFKTEKFVTNPALYDELAKGQSPKFMVFACSDSRVCPSHVLDFQPGEAF
VVRNVANMVPPFDKTKYSGVGAAVEYAVLHLKVQEIFVIGHSRCGGIKGLMTFPDEGPHS
TDFIEDWVKVCLPAKSKVVAEHNGTHLDDQCVLCEKEAVNVSLGNLLTYPFVRDGLRNKT
LALKGGHYDFVNGTFELWALDFGLSSPTSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10880
NameBDBM10880
Synonyms:AZA | AZA2 | AZM acetazolamide | Acerazolamide, AAZ | Acetazolamide | Acetazolamide (AAZ) | Acetazolamide (AZA) | Acetazolamide (AZM) | Acetazolamide, 5 | Acetazolamide, AAZ | Acetazolamide, AZA | Acetazolamide, AZM | CHEMBL20 | N-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)acetamide | Sulfonamide, 1 | US10172837, Acetazolamide | sulfonamide 1
TypeSmall organic molecule
Emp. Form.C4H6N4O3S2
Mol. Mass.222.245
SMILESCC(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
n/a