Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
LigandBDBM50445324
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1285325
IC50 140±n/a nM
Citation Luo, SZhangsun, DZhu, XWu, YHu, YChristensen, SHarvey, PJAkcan, MCraik, DJMcIntosh, JM Characterization of a novela-conotoxin TxID from Conus textile that potently blocks rata34 nicotinic acetylcholine receptors. J Med Chem56:9655-63 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Name:Nicotinic acetylcholine receptor alpha6/alpha3/beta2/beta3
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 1285295
Components:This complex has 4 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-6/beta-3
Synonyms:Neuronal acetylcholine receptor subunit alpha-6
Type:PROTEIN
Mol. Mass.:56943.53
Organism:Rattus norvegicus
Description:ChEMBL_1454451
Residue:493
Sequence:
MLNGWGRGDLRSGLCLWICGFLAFFKGSRGCVSEEQLFHTLFAHYNRFIRPVENVSDPVT
VHFELAITQLANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDI
VLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTMFLQVFPSILMMRRPLD
KTKEMDGVKDPKTHTKRPAKVKFTHRKEPKLLKECRHCHKSSEIAPGKRLSQQPAQWVTE
NSEHPPDVEDVIDSVQFIAENMKSHNETKEVEDDWKYMAMVVDRVFLWVFIIVCVFGTVG
LFLQPLLGNTGAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:NIcotinic acetylcholine receptor alpha-3/beta-4/alpha-5
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:Neuronal acetylcholine receptor protein beta-3 subunit
Synonyms:Neuronal acetylcholine receptor subunit beta-3
Type:PROTEIN
Mol. Mass.:53270.05
Organism:Rattus norvegicus
Description:EBI_10644
Residue:464
Sequence:
MTGFLRVFLVLSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKWVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEEYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQRLPRWLCMKDPMD
RFSFPDGKESDTAVRGKVSGKRKQTPASDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLIASVLGSILIFIPALKMWIHRFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Neuronal acetylcholine receptor protein beta-3 subunit
Synonyms:Neuronal acetylcholine receptor subunit beta-3
Type:PROTEIN
Mol. Mass.:53270.05
Organism:Rattus norvegicus
Description:EBI_10644
Residue:464
Sequence:
MTGFLRVFLVLSATLSGSWVTLTATAGLSSVAEHEDALLRHLFQGYQKWVRPVLNSSDII
KVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDQKLRWNPEEYGGINSIKVPSESLWLPD
IVLFENADGRFEGSLMTKAIVKSSGTVSWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSW
TYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRREGFYSYPFVTYSFVLRRLPL
FYTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIP
LIGEYLLFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQRLPRWLCMKDPMD
RFSFPDGKESDTAVRGKVSGKRKQTPASDGERVLVAFLEKASESIRYISRHVKKEHFISQ
VVQDWKFVAQVLDRIFLWLFLIASVLGSILIFIPALKMWIHRFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50445324
NameBDBM50445324
Synonyms:CHEMBL3104237
TypeSmall organic molecule
Emp. Form.C71H103N23O25S4
Mol. Mass.1806.977
SMILESCC[C@H](C)[C@@H]1NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]2CCCN2C(=O)[C@H](Cc2cnc[nH]2)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]2CSSC[C@H](NC(=O)CN)C(=O)N[C@@H](CSSC[C@H](NC1=O)C(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(=O)N2 |r,wU:67.70,91.95,108.112,62.127,42.44,24.25,17.21,4.3,wD:76.78,97.101,112.117,54.57,34.36,8.8,2.2,81.88,(55.19,-36.32,;53.78,-35.65,;52.52,-36.52,;52.65,-38.06,;51.13,-35.87,;51.01,-34.33,;52.27,-33.46,;53.66,-34.12,;52.15,-31.93,;50.75,-31.26,;49.48,-32.14,;48.1,-31.48,;47.97,-29.94,;46.83,-32.36,;53.41,-31.05,;53.28,-29.52,;51.9,-28.85,;54.5,-28.57,;55.91,-29.23,;56.84,-27.84,;55.8,-26.53,;54.23,-27.08,;52.9,-26.34,;51.56,-27.13,;52.88,-24.78,;54.19,-24.01,;55.72,-24.26,;56.82,-23.2,;58.17,-23.91,;57.93,-25.42,;56.4,-25.64,;51.54,-24.04,;51.53,-22.49,;52.85,-21.71,;50.2,-21.74,;48.86,-22.53,;48.88,-24.06,;47.55,-24.85,;50.21,-24.8,;50.18,-20.18,;48.86,-19.44,;47.51,-20.23,;48.83,-17.88,;50.14,-17.11,;51.5,-17.87,;52.82,-17.11,;54.16,-17.87,;54.16,-19.4,;55.5,-20.15,;52.83,-20.18,;51.5,-19.42,;47.5,-17.13,;46.17,-16.36,;46.17,-14.84,;44.84,-17.12,;44.84,-18.68,;46.17,-19.45,;47.49,-18.68,;46.17,-20.99,;43.51,-16.35,;42.18,-17.11,;42.18,-18.66,;40.83,-16.33,;40.83,-14.82,;42.18,-14.03,;20.03,-14.1,;18.58,-14.61,;18.28,-16.11,;16.83,-16.62,;15.67,-15.61,;15.96,-14.1,;14.21,-16.11,;13.04,-15.1,;19.45,-17.12,;19.15,-18.64,;20.91,-16.63,;22.06,-17.64,;21.77,-19.15,;22.93,-20.16,;46.07,-39.37,;47.33,-38.5,;48.73,-39.15,;49.99,-38.28,;49.87,-36.74,;48.48,-36.09,;48.85,-40.69,;47.58,-41.56,;50.24,-41.34,;23.52,-17.13,;23.82,-15.62,;24.68,-18.15,;26.14,-17.64,;26.43,-16.13,;27.88,-15.64,;27.3,-18.65,;27.01,-20.16,;28.75,-18.14,;29.92,-19.16,;29.63,-20.66,;30.79,-21.67,;30.51,-23.18,;32.26,-21.16,;31.37,-18.65,;32.54,-19.65,;31.58,-17.12,;30.46,-15.87,;31.29,-14.42,;32.93,-14.77,;32.83,-16.32,;34.18,-17.09,;34.18,-18.62,;35.51,-16.32,;36.85,-17.09,;36.85,-18.64,;38.17,-19.4,;38.17,-20.95,;39.49,-21.72,;39.49,-23.27,;40.81,-24.03,;38.14,-24.05,;38.16,-16.32,;38.16,-14.8,;39.51,-17.1,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a