Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGTP-binding protein Rheb
LigandBDBM29608
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1287899
Kd 1800000±n/a nM
Citation Schöpel, MJockers, KFDüppe, PMAutzen, JPotheraveedu, VNInce, SYip, KTHeumann, RHerrmann, CScherkenbeck, JStoll, R Bisphenol A binds to Ras proteins and competes with guanine nucleotide exchange: implications for GTPase-selective antagonists. J Med Chem56:9664-72 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GTP-binding protein Rheb
Name:GTP-binding protein Rheb
Synonyms:RHEB | RHEB2 | Ras homolog enriched in brain
Type:PROTEIN
Mol. Mass.:20495.73
Organism:Homo sapiens (Human)
Description:ChEMBL_108016
Residue:184
Sequence:
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29608
NameBDBM29608
Synonyms:Bisphenol A (BPA) | Diphenylolpropane | US9688816, L
TypeSmall organic molecule
Emp. Form.C15H16O2
Mol. Mass.228.2863
SMILESCC(C)(c1ccc(O)cc1)c1ccc(O)cc1
Structure
n/a