Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGTP-binding protein Rheb
LigandBDBM50121958
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1287899
Kd 1500000±n/a nM
Citation Schöpel, MJockers, KFDüppe, PMAutzen, JPotheraveedu, VNInce, SYip, KTHeumann, RHerrmann, CScherkenbeck, JStoll, R Bisphenol A binds to Ras proteins and competes with guanine nucleotide exchange: implications for GTPase-selective antagonists. J Med Chem56:9664-72 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GTP-binding protein Rheb
Name:GTP-binding protein Rheb
Synonyms:RHEB | RHEB2 | Ras homolog enriched in brain
Type:PROTEIN
Mol. Mass.:20495.73
Organism:Homo sapiens (Human)
Description:ChEMBL_108016
Residue:184
Sequence:
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS
CSVM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121958
NameBDBM50121958
Synonyms:4,4'-Biphenyldiol | 4,4'-Dihydroxybiphenyl | 4,4'-biphenol | 4,4'-dioxydiphenyl | CHEMBL76398 | DOD | US9688816, 6 | [1,1'-biphenyl]-4,4'-diol | biphenyl-4,4'-diol | p,p'-biphenol | p,p'-dihydroxybiphenyl
TypeSmall organic molecule
Emp. Form.C12H10O2
Mol. Mass.186.2066
SMILESOc1ccc(cc1)-c1ccc(O)cc1
Structure
n/a