Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 3a (5-HT3a)/3b (5-HT3b) receptor
LigandBDBM50455980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_4330
Kd 36±n/a nM
Citation Bradley, GWard, TJWhite, JCColeman, JTaylor, ARhodes, KF Novel antagonists of the 5-HT3 receptor. Synthesis and structure-activity relationships of (2-alkoxybenzoyl)ureas. J Med Chem35:1515-20 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
Name:Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
Synonyms:Serotonin 3 (5-HT3) receptor
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 2974
Components:This complex has 2 components.
Component 1
Name:Serotonin (5-HT) receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50328.78
Organism:Rattus norvegicus
Description:EBI_11885
Residue:437
Sequence:
MILLWSCLLVAVVGILGTATPQPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLC
VHAVLDVDVQNQKLKTSMWYREVWNDEFLSWNSSLFDDIQEISLPLSAIWAPDIIINEFV
DVERSPDLPYVYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDID
LGFLRNQEDIENDKRSFLNDSEWQLLSVTSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVV
SLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTSLIGV
FFTVCMALLVLSLSKSILLIKFLYEERHSEQERPLMCLRGDSDANESRLYLRAPCAEDTE
SPVRQEHQVPSDTLKDFWFQLQSINNSLRTRDQVYQKEVEWLAILCHFDQLLFRIYLAVL
GLYTVTLCSLWALWSRM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Serotonin (5-HT) receptor
Synonyms:5-HT3 | 5-hydroxytryptamine receptor 3A | Zacopride site-R
Type:Enzyme Catalytic Domain
Mol. Mass.:55428.70
Organism:RAT
Description:5-HT3 HTR3A RAT::P35563
Residue:483
Sequence:
MPLCIPQVLLALFLSVLIAQGEGSRRRATQAHSTTQPALLRLSDHLLANYKKGVRPVRDW
RKPTLVSIDVIMYAILNVDEKNQVLTTYIWYRQFWTDEFLQWTPEDFDNVTKLSIPTDSI
WVPDILINEFVDVGKSPSIPYVYVHHQGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTF
TSWLHTIQDINISLWRTPEEVRSDKSIFINQGEWELLGVFTKFQEFSIETSNSYAEMKFY
VVIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTL
PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRHLVLDRIAWLL
CLGEQPMAHRPPATFQANKTDDCSAMGNHCSHVGSPQDLEKTSRSRDSPLPPPREASLAV
RGLLQELSSIRHSLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTLWSIW
HYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50455980
NameBDBM50455980
Synonyms:CHEMBL37419
TypeSmall organic molecule
Emp. Form.C18H22N2O8
Mol. Mass.394.3759
SMILESOC(=O)C(O)=O.COc1ccccc1C(=O)NC(=O)OC1CN2CCC1CC2 |(16.92,-15.69,;16.14,-14.38,;16.88,-13.04,;14.61,-14.41,;13.87,-15.76,;13.8,-13.1,;-1.85,-12.78,;-.51,-13.53,;-.5,-15.06,;-1.83,-15.83,;-1.83,-17.39,;-.5,-18.16,;.83,-17.39,;.83,-15.83,;2.16,-15.06,;2.15,-13.53,;3.49,-15.82,;4.82,-15.05,;4.82,-13.52,;6.16,-15.8,;7.47,-15.03,;8.87,-15.83,;10.26,-15.03,;10.26,-13.4,;8.87,-12.6,;7.47,-13.4,;9.17,-13.82,;8.04,-14.73,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a