Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlandular kallikrein
LigandBDBM50010136
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1354676
Ki 2200±n/a nM
Citation Geratz, JDCheng, MCTidwell, RR Novel bis(benzamidino) compounds with an aromatic central link. Inhibitors of thrombin, pancreatic kallikrein, trypsin, and complement. J Med Chem19:634-9 (1976) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glandular kallikrein
Name:Glandular kallikrein
Synonyms:Tissue kallikrein
Type:PROTEIN
Mol. Mass.:26710.38
Organism:Sus scrofa
Description:ChEMBL_108296
Residue:242
Sequence:
APPIQSRIIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGR
HNLFENENTAQFFGVTADFPHPGFNLSLLKHTKADGKDYSHDLMLLRLQSPAKITDAVKV
LELPTQEPELGSTCEASGWGSIEPGPDFEFPDEIQCVQLTLLQNTFCAAHPKVTESMLCA
GYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWINDTITE
NP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010136
NameBDBM50010136
Synonyms:CHEMBL3245422
TypeSmall organic molecule
Emp. Form.C28H24Br2N4O2
Mol. Mass.608.324
SMILESNC(=N)c1ccc(OCc2cccc(c2)-c2cccc(COc3ccc(cc3Br)C(N)=N)c2)c(Br)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a