Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase ITK/TSK
LigandBDBM50022933
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1369124
IC50 5200±n/a nM
Citation Burch, JDLau, KBarker, JJBrookfield, FChen, YChen, YEigenbrot, CEllebrandt, CIsmaili, MHJohnson, AKordt, DMacKinnon, CHMcEwan, PAOrtwine, DFStein, DBWang, XWinkler, DYuen, PWZhang, YZarrin, AAPei, Z Property- and structure-guided discovery of a tetrahydroindazole series of interleukin-2 inducible T-cell kinase inhibitors. J Med Chem57:5714-27 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase ITK/TSK
Name:Tyrosine-protein kinase ITK/TSK
Synonyms:ITK | Kinase EMT | T-cell-specific kinase | Tyrosine-protein kinase ITK | Tyrosine-protein kinase ITK (ITK) | Tyrosine-protein kinase Lyk
Type:Protein
Mol. Mass.:71839.20
Organism:Homo sapiens (Human)
Description:n/a
Residue:620
Sequence:
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKY
HPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALY
DYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTKAVVSENNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAGLRYGKWVIDP
SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
LYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIH
RDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSD
VWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPE
DRPAFSRLLRQLAEIAESGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022933
NameBDBM50022933
Synonyms:CHEMBL3298288
TypeSmall organic molecule
Emp. Form.C20H23N5O
Mol. Mass.349.4295
SMILESCC1(C)CCc2c(C1)[nH]nc2C(=O)Nc1cnn(Cc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a