Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein phosphatase 1D
LigandBDBM50046676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1451879
IC50<20000±n/a nM
Citation Cheeseman, MDFaisal, ARayter, SBarbeau, ORKalusa, AWestlake, MBurke, RSwan, Mvan Montfort, RLinardopoulos, SJones, K Targeting the PPM1D phenotype; 2,4-bisarylthiazoles cause highly selective apoptosis in PPM1D amplified cell-lines. Bioorg Med Chem Lett24:3469-74 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein phosphatase 1D
Name:Protein phosphatase 1D
Synonyms:PP2C-delta | Protein phosphatase 2C isoform delta | Protein phosphatase magnesium-dependent 1 delta | p53-induced protein phosphatase 1
Type:PROTEIN
Mol. Mass.:66695.55
Organism:Homo sapiens (Human)
Description:ChEMBL_1515094
Residue:605
Sequence:
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPG
GEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHL
WGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSG
VNRVVWKRPRLTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT
LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQ
RMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVK
SLEEDPWPRVNSKDHIPALVRSNAFSENFLEVSAEIARENVQGVVIPSKDPEPLEENCAK
ALTLRIHDSLNNSLPIGLVPTNSTNTVMDQKNLKMSTPGQMKAQEIERTPPTNFKRTLEE
SNSGPLMKKHRRNGLSRSSGAQPASLPTTSQRKNSVKLTMRRRLRGQKKIGNPLLHQHRK
TVCVC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50046676
NameBDBM50046676
Synonyms:CHEMBL3314475
TypeSmall organic molecule
Emp. Form.C19H16FN3O2S
Mol. Mass.369.413
SMILESCN(C)Cc1cc(F)ccc1-c1nc(cs1)-c1ccc2[nH]c(=O)oc2c1
Structure
n/a