Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
LigandBDBM50086430
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1476004
IC50 6.0±n/a nM
Citation Haffner, CDBecherer, JDBoros, EECadilla, RCarpenter, TCowan, DDeaton, DNGuo, YHarrington, WHenke, BRJeune, MRKaldor, IMilliken, NPetrov, KGPreugschat, FSchulte, CShearer, BGShearer, TSmalley, TLStewart, ELStuart, JDUlrich, JC Discovery, Synthesis, and Biological Evaluation of Thiazoloquin(az)olin(on)es as Potent CD38 Inhibitors. J Med Chem58:3548-71 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Name:ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
Synonyms:2''-phospho-ADP-ribosyl cyclase | 2''-phospho-ADP-ribosyl cyclase/2''-phospho-cyclic-ADP-ribose transferase | 2''-phospho-cyclic-ADP-ribose transferase | ADP-ribosyl cyclase 1 | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 | ADPRC 1 | CD_antigen=CD38 | Cd38 | Cyclic ADP-ribose hydrolase 1 | I-19 | NIM-R5 antigen | cADPr hydrolase 1
Type:PROTEIN
Mol. Mass.:34417.04
Organism:Mus musculus
Description:ChEMBL_109609
Residue:304
Sequence:
MANYEFSQVSGDRPGCRLSRKAQIGLGVGLLVLIALVVGIVVILLRPRSLLVWTGEPTTK
HFSDIFLGRCLIYTQILRPEMRDQNCQEILSTFKGAFVSKNPCNITREDYAPLVKLVTQT
IPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYVSCPHW
SENCPNNPITVFWKVISQKFAEDACGVVQVMLNGSLREPFYKNSTFGSVEVFSLDPNKVH
KLQAWVMHDIEGASSNACSSSSLNELKMIVQKRNMIFACVDNYRPARFLQCVKNPEHPSC
RLNT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086430
NameBDBM50086430
Synonyms:CHEMBL3426031
TypeSmall organic molecule
Emp. Form.C19H21N3O2S
Mol. Mass.355.454
SMILESCc1cc(cc2c(NC3CCOCC3)cc(=O)n(C)c12)-c1cncs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a