Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-2C adrenergic receptor
LigandBDBM50001922
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1504524
EC50 55±n/a nM
Citation Szollosi, EBobok, AKiss, LVass, MKurkó, DKolok, SVisegrády, AKeseru, GM Cell-based and virtual fragment screening for adrenergica2C receptor agonists. Bioorg Med Chem23:3991-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha-2C adrenergic receptor
Name:Adrenergic receptor alpha
Synonyms:Adrenergic alpha2C | Adrenergic receptor alpha | Adrenergic, alpha-2C-, receptor | Alpha-2 adrenergic receptor subtype C4 | Alpha-2C adrenoceptor | Alpha-2C adrenoreceptor | adrenergic, alpha-2C-, receptor [Homo sapiens]
Type:Enzyme
Mol. Mass.:49552.32
Organism:Homo sapiens (Human)
Description:P18825
Residue:462
Sequence:
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50001922
NameBDBM50001922
Synonyms:2-Naphthalen-1-ylmethyl-4,5-dihydro-1H-imidazole; hydrochloride | Albalon | CHEMBL1706 | NAPHAZOLINE | NAPHAZOLINE HYDROCHLORIDE | Nafazair | Naphazoline | Naphazoline Nitrate | Naphcon forte | Opcon | Vasocon | cid_11079
TypeSmall organic molecule
Emp. Form.C14H14N2
Mol. Mass.210.2744
SMILESC(C1=NCCN1)c1cccc2ccccc12 |t:1|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a