Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransmembrane domain-containing protein TMIGD3
LigandBDBM50118803
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1556380
IC50 42±n/a nM
Citation Donegan, RKLieberman, RL Discovery of Molecular Therapeutics for Glaucoma: Challenges, Successes, and Promising Directions. J Med Chem59:788-809 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transmembrane domain-containing protein TMIGD3
Name:Transmembrane domain-containing protein TMIGD3
Synonyms:TMIGD3 | Transmembrane domain-containing protein TMIGD3
Type:PROTEIN
Mol. Mass.:30335.79
Organism:Homo sapiens (Human)
Description:ChEMBL_114868
Residue:266
Sequence:
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118803
NameBDBM50118803
Synonyms:(2R,3R,4S,5S)-3,4-dihydroxy-2-[6-(3-iodo-benzylamino)-purin-9-yl]-1-oxa-7-aza-spiro[4.4]nonan-6-one | 3,4-Dihydroxy-2-[6-(3-iodo-benzylamino)-purin-9-yl]-1-oxa-7-aza-spiro[4.4]nonan-6-one | CHEMBL344187
TypeSmall organic molecule
Emp. Form.C19H19IN6O4
Mol. Mass.522.2964
SMILESO[C@@H]1[C@H](O)[C@]2(CCNC2=O)O[C@H]1n1cnc2c(NCc3cccc(I)c3)ncnc12
Structure
n/a