Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransmembrane domain-containing protein TMIGD3
LigandBDBM50163874
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1573808
Ki 6±n/a nM
Citation Tosh, DKCiancetta, AWarnick, EO'Connor, RChen, ZGizewski, ECrane, SGao, ZGAuchampach, JASalvemini, DJacobson, KA Purine (N)-Methanocarba Nucleoside Derivatives Lacking an Exocyclic Amine as Selective A3 Adenosine Receptor Agonists. J Med Chem59:3249-63 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transmembrane domain-containing protein TMIGD3
Name:Transmembrane domain-containing protein TMIGD3
Synonyms:TMIGD3 | Transmembrane domain-containing protein TMIGD3
Type:PROTEIN
Mol. Mass.:30335.79
Organism:Homo sapiens (Human)
Description:ChEMBL_114868
Residue:266
Sequence:
MEGSPAGPIEQKEARWESSWEEQPDWTLGCLSPESQFRIPGLPGCILSFQLKVCFLPVMW
LFILLSLALISDAMVMDEKVKRSFVLDTASAICNYNAHYKNHPKYWCRGYFRDYCNIIAF
SPNSTNHVALRDTGNQLIVTMSCLTKEDTGWYWCGIQRDFARDDMDFTELIVTDDKGTLA
NDFWSGKDLSGNKTRSCKAPKVVRKADRSRTSILIICILITGLGIISVISHLTKRRRSQR
NRRVGNTLKPFSRVLTPKEMAPTEQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50163874
NameBDBM50163874
Synonyms:CHEMBL3800048
TypeSmall organic molecule
Emp. Form.C22H21N5O3
Mol. Mass.403.4338
SMILES[H][C@]12C[C@]1([C@@H](O)[C@@H](O)[C@@H]2n1cnc2c(C)nc(nc12)C#Cc1ccccc1)C(=O)NC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a