Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50034354
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1576315
Ki 11±n/a nM
Citation Zou, MFKeck, TMKumar, VDonthamsetti, PMichino, MBurzynski, CSchweppe, CBonifazi, AFree, RBSibley, DRJanowsky, AShi, LJavitch, JANewman, AH Novel Analogues of (R)-5-(Methylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (Sumanirole) Provide Clues to Dopamine D2/D3 Receptor Agonist Selectivity. J Med Chem59:2973-88 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50034354
NameBDBM50034354
Synonyms:(R)-5-Dipropylamino-5,6-dihydro-1H,4H-imidazo[4,5,1-ij]quinolin-2-one | (R)5-Dipropylamino-5,6-dihydro-1H,4H-imidazo[4,5,1-ij]quinolin-2-one | CHEMBL26181
TypeSmall organic molecule
Emp. Form.C16H23N3O
Mol. Mass.273.3733
SMILESCCCN(CCC)[C@@H]1Cc2cccc3[nH]c(=O)n(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a