Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNAD-dependent protein deacetylase sirtuin-3 (SIRT3)
LigandBDBM50168833
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1577533
IC50 18500±n/a nM
Citation Ai, TWilson, DJMore, SSXie, JChen, L 5-((3-Amidobenzyl)oxy)nicotinamides as Sirtuin 2 Inhibitors. J Med Chem59:2928-41 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NAD-dependent protein deacetylase sirtuin-3 (SIRT3)
Name:NAD-dependent deacetylase sirtuin 3
Synonyms:NAD-dependent deacetylase sirtuin 3
Type:Protein
Mol. Mass.:43582.69
Organism:Homo sapiens (Human)
Description:Q9NTG7
Residue:399
Sequence:
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50168833
NameBDBM50168833
Synonyms:CHEMBL3804923
TypeSmall organic molecule
Emp. Form.C22H19N3O3
Mol. Mass.373.4046
SMILESNC(=O)c1cncc(OCc2cccc(NC(=O)\C=C\c3ccccc3)c2)c1
Structure
n/a