Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphatidylinositol 4-kinase type 2-alpha
LigandBDBM50228346
Substrate/Competitorn/a
Meas. Tech.ChEMBL_152907
Ki 11000±n/a nM
Citation Young, RCJones, MMilliner, KJRana, KKWard, JG Purine derivatives as competitive inhibitors of human erythrocyte membrane phosphatidylinositol 4-kinase. J Med Chem33:2073-80 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Phosphatidylinositol 4-kinase type 2-alpha
Name:Phosphatidylinositol 4-kinase type 2-alpha
Synonyms:PI4K2A | Phosphatidylinositol 4-kinase type 2-alpha | Phosphatidylinositol 4-kinase type II-alpha
Type:PROTEIN
Mol. Mass.:54030.26
Organism:Homo sapiens (Human)
Description:ChEMBL_104812
Residue:479
Sequence:
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQP
LLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELA
IERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFG
RDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEK
VPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVL
DYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWR
AYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50228346
NameBDBM50228346
Synonyms:CHEMBL65685
TypeSmall organic molecule
Emp. Form.C17H13N5
Mol. Mass.287.3186
SMILESNc1ncnc2n(c(nc12)-c1ccccc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a