Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50008705
Substrate/Competitorn/a
Meas. Tech.ChEMBL_42939
IC50 1800±n/a nM
Citation Vinick, FJSaccomano, NAKoe, BKNielsen, JAWilliams, IHThadeio, PFJung, SMeltz, MJohnson, JLebel, LA Nicotinamide ethers: novel inhibitors of calcium-independent phosphodiesterase and [3H]rolipram binding. J Med Chem34:86-9 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Synonyms:DPDE1 | Dpde1 | Pde4c | cAMP-specific 3'',5''-cyclic phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:60038.21
Organism:Rattus norvegicus
Description:ChEMBL_104732
Residue:536
Sequence:
NSSRTSSAASDLHGEDMIVTPFAQVLASLRTVRSNVAALAHGAGSATRQALLGTPPQSSQ
QAAPAEESGLQLAQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRELTHLSETSR
SGNQVSEYISQTFLDQQAEVELPAPPTEDHPWPMAQITGLRKSCHTSLPTAAIPRFGVQT
DQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAVIFRVLQERDLLKTFQIPADTLLRYL
LTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPG
VSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQNLSTKQKLSLRRMVID
MVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPL
PLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWAD
LVHPDAQELLDTLEDNREWYQSRVPCSPPHAIGPDRFKFELTLEETEEEEEEDERH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50008705
NameBDBM50008705
Synonyms:CHEMBL168418 | N-Benzyl-2-phenoxy-nicotinamide
TypeSmall organic molecule
Emp. Form.C19H16N2O2
Mol. Mass.304.3425
SMILESO=C(NCc1ccccc1)c1cccnc1Oc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a