Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4C
LigandBDBM50229040
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157210
IC50 1.3±n/a nM
Citation Lowe, JAArcher, RLChapin, DSChen, JBHelweg, DJohnson, JLKoe, BKLebel, LAMoore, PFNielsen, JA Structure-activity relationship of quinazolinedione inhibitors of calcium-independent phosphodiesterase. J Med Chem34:624-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4C
Synonyms:DPDE1 | Dpde1 | Pde4c | cAMP-specific 3'',5''-cyclic phosphodiesterase 4C
Type:PROTEIN
Mol. Mass.:60038.21
Organism:Rattus norvegicus
Description:ChEMBL_104732
Residue:536
Sequence:
NSSRTSSAASDLHGEDMIVTPFAQVLASLRTVRSNVAALAHGAGSATRQALLGTPPQSSQ
QAAPAEESGLQLAQETLEELDWCLEQLETLQTRRSVGEMASNKFKRMLNRELTHLSETSR
SGNQVSEYISQTFLDQQAEVELPAPPTEDHPWPMAQITGLRKSCHTSLPTAAIPRFGVQT
DQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAVIFRVLQERDLLKTFQIPADTLLRYL
LTLEGHYHSNVAYHNSIHAADVVQSAHVLLGTPALEAVFTDLEVLAAIFACAIHDVDHPG
VSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQGENCDIFQNLSTKQKLSLRRMVID
MVLATDMSKHMSLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQSLVHCADLSNPAKPL
PLYRQWTERIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETWAD
LVHPDAQELLDTLEDNREWYQSRVPCSPPHAIGPDRFKFELTLEETEEEEEEDERH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229040
NameBDBM50229040
Synonyms:CHEMBL156140
TypeSmall organic molecule
Emp. Form.C22H17N3O4
Mol. Mass.387.3881
SMILESCOC(=O)c1cccc(c1)-n1c2ncccc2c(=O)n(Cc2ccccc2)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a