Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor
LigandBDBM50229903
Substrate/Competitorn/a
Meas. Tech.ChEBML_41451
IC50>50±n/a nM
Citation Lanza, TJDurette, PLRollins, TSiciliano, SCianciarulo, DNKobayashi, SVCaldwell, CGSpringer, MSHagmann, WK Substituted 4,6-diaminoquinolines as inhibitors of C5a receptor binding. J Med Chem35:252-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229903
NameBDBM50229903
Synonyms:CHEMBL313206
TypeSmall organic molecule
Emp. Form.C26H28N6O2
Mol. Mass.456.5395
SMILESCc1cc(N)c2cc(NC(=O)CCCCC(=O)Nc3ccc4nc(C)cc(N)c4c3)ccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a