Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyeloperoxidase (MPO)
LigandBDBM50229904
Substrate/Competitorn/a
Meas. Tech.ChEMBL_223053
EC50 0.000000±n/a nM
Citation Lanza, TJDurette, PLRollins, TSiciliano, SCianciarulo, DNKobayashi, SVCaldwell, CGSpringer, MSHagmann, WK Substituted 4,6-diaminoquinolines as inhibitors of C5a receptor binding. J Med Chem35:252-8 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Myeloperoxidase (MPO)
Name:Myeloperoxidase
Synonyms:84 kDa myeloperoxidase | 89 kDa myeloperoxidase | MPO | Mpo protein | Myeloperoxidase | Myeloperoxidase heavy chain | Myeloperoxidase light chain
Type:Enzyme
Mol. Mass.:83888.32
Organism:Homo sapiens (Human)
Description:P05164
Residue:745
Sequence:
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50229904
NameBDBM50229904
Synonyms:CHEMBL87465
TypeSmall organic molecule
Emp. Form.C19H15Cl2N3O
Mol. Mass.372.248
SMILESCc1cc(N)c2cc(NC(=O)\C=C\c3c(Cl)cccc3Cl)ccc2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a