Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 7
LigandBDBM50236191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1658795
EC50 714±n/a nM
Citation Beesu, MSalyer, ACBrush, MJTrautman, KLHill, JKDavid, SA Identification of High-Potency Human TLR8 and Dual TLR7/TLR8 Agonists in Pyrimidine-2,4-diamines. J Med Chem60:2084-2098 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 7
Name:Toll-like receptor 7
Synonyms:ORF Names:UNQ248/PRO285 | TLR7 | Toll-like receptor 7 (TLR7)
Type:Enzyme
Mol. Mass.:120945.35
Organism:Homo sapiens (Human)
Description:Q9NYK1
Residue:1049
Sequence:
MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP
GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP
RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG
QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI
QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN
SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM
NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF
KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK
EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP
LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK
LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN
SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN
CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL
HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL
ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK
DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK
YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ
AHPYFWQCLKNALATDNHVAYSQVFKETV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50236191
NameBDBM50236191
Synonyms:CHEMBL4083025
TypeSmall organic molecule
Emp. Form.C16H29N5S
Mol. Mass.323.5
SMILESCCCCNc1nc(N)nc(C)c1CCCN1CCSCC1
Structure
n/a