Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(3) dopamine receptor
LigandBDBM50056443
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1661600
Ki 573±n/a nM
Citation Bonifazi, AYano, HEllenberger, MPMuller, LKumar, VZou, MFCai, NSGuerrero, AMWoods, ASShi, LNewman, AH Novel Bivalent Ligands Based on the Sumanirole Pharmacophore Reveal Dopamine D J Med Chem60:2890-2907 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
D(3) dopamine receptor
Name:D(3) dopamine receptor
Synonyms:D2-like dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor | Dopamine D3 receptor (D3) | Dopamine D3 receptor (D3R) | Dopamine receptor | Dopamine receptor (D3) | Dopamine receptor D3
Type:n/a
Mol. Mass.:44243.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:400
Sequence:
MASLSQLSSHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTV
CSISNPDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQCNSVRPGFPQ
QTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRK
LSNGRLSTSLKLGPLQPRGVPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCHV
SPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056443
NameBDBM50056443
Synonyms:(R)-5-Methylamino-5,6-dihydro-1H,4H-imidazo[4,5,1-ij]quinolin-2-one | CHEMBL419792 | PNU-95666E
TypeSmall organic molecule
Emp. Form.C11H13N3O
Mol. Mass.203.2404
SMILESCN[C@@H]1Cc2cccc3[nH]c(=O)n(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a